Tesamorelin vs Sermorelin: Differences in Research

Why these two peptides get compared

Tesamorelin and sermorelin sit in the same family. Each is built from the sequence of human GHRH, the hypothalamic peptide that binds the GHRH receptor on pituitary somatotroph cells and drives cyclic AMP signaling in those cells. Because they share a receptor and a common N-terminal sequence, researchers often ask which one suits a given assay, and what is actually different between the two once you look at the molecules rather than the marketing.

This article stays on the bench-science side of that question: sequence, chemistry, stability, handling, and documentation. It does not discuss human use, outcomes, or any regulatory status of either compound. Everything we sell, including Tesamorelin and Sermorelin, is a laboratory research material intended for in vitro and preclinical work only.

Sequence and structure

Sermorelin: the 1-29 fragment

Native human GHRH is a 44-residue peptide amidated at the C-terminus. Early structure-activity work showed that the N-terminal 29 residues keep most of the receptor-binding and activating behavior of the full molecule. Sermorelin is that fragment, GRF(1-29), with a C-terminal amide. Its sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. The molecular formula is roughly C149H246N44O42S and the average mass is about 3,358 Da.

For a deeper look at how it is made and characterized, see our page on sermorelin chemical structure and synthesis.

Tesamorelin: the full 44 residues plus a lipid-like cap

Tesamorelin keeps the entire 44-residue GHRH sequence and adds a trans-3-hexenoyl group to the N-terminal tyrosine. The extra residues run from position 30 to 44 (QQGESNQERGARARL, C-terminal amide). The molecular formula is roughly C221H366N72O67S and the average mass is about 5,136 Da for the free base. It is usually supplied as an acetate salt, so the gross weight of a lyophilized cake includes counter-ions and residual water.

The hexenoyl modification is a small six-carbon acyl group, not a large carrier or polymer. It does not change the amino acid chain; it caps the free amine at the N-terminus. Our overview of tesamorelin chemical structure and synthesis covers the synthetic route and the impurities that tend to appear, and what is Tesa (tesamorelin) peptide gives a plain-language orientation.

Why the N-terminal cap matters for stability

Native GHRH and sermorelin both begin Tyr-Ala-Asp. The bond between Ala2 and Asp3 is a recognition site for dipeptidyl peptidase-IV (DPP-IV), which removes the first two residues and leaves a fragment (GHRH 3-29 or 3-44) with much weaker receptor activity. In biological matrices such as plasma or tissue homogenate, this cleavage is the main reason unmodified GHRH analogs have very short half-lives, on the order of minutes for sermorelin in published characterizations.

The trans-3-hexenoyl group on tesamorelin sits at the exact position DPP-IV needs to engage. Blocking access to that site slows the first cleavage step, so the intact peptide persists longer in matrices that contain the enzyme. That is the central structural difference between the two molecules, and it is a statement about enzymatic degradation in an assay, not about any outcome in a living organism.

Two other stability points are worth keeping apart:

• Enzymatic stability (how fast peptidases cut the chain) favors tesamorelin because of the N-terminal cap.
• Chemical stability (oxidation, deamidation, hydrolysis in solution) is a property of the sequence and the conditions. Both peptides contain a methionine (position 27), which can oxidize to the sulfoxide, and both contain Asn and Asp residues that can undergo deamidation or isomerization over time. The longer tesamorelin chain has more sites of this kind simply because it has more residues.

Receptor and mechanism at the bench

Both compounds bind the GHRH receptor, a class B G-protein-coupled receptor expressed on pituitary somatotrophs. Receptor activation couples to Gs, raises intracellular cAMP and activates protein kinase A. In cell-based assays this is read out as cAMP accumulation, CRE-reporter activity or downstream hormone release in primary pituitary cultures.

The N-terminal region of GHRH is primarily responsible for activating the receptor, while the middle of the chain contributes to binding affinity. Because sermorelin already contains both regions, it behaves as a full agonist in most in vitro systems. Tesamorelin shares the same activating region and adds the extra C-terminal residues. Differences in measured potency between the two depend heavily on the assay: in a system with little peptidase activity, the two can look similar, whereas in matrices with active DPP-IV the persistence of the intact peptide diverges.

For fuller mechanism write-ups, see sermorelin mechanism of action and tesamorelin mechanism of action. If you are weighing sermorelin against a ghrelin-receptor peptide instead, sermorelin vs ipamorelin covers that pairing.

Side-by-side comparison

Handling and storage as lyophilized materials

Both peptides are normally supplied freeze-dried. Lyophilization removes water so that hydrolysis, deamidation and microbial growth are slowed while the material sits on a shelf; our primer on what lyophilization is explains why. The practical handling rules are largely shared:

• Keep sealed vials cold and dark, and let a vial reach room temperature before opening so that condensation does not wet the cake. General guidance is collected in storing research peptides.
• Minimize time in solution. Once a peptide is dissolved, chemical degradation and adsorption to plastic both accelerate. Prepare only what an experiment needs and avoid repeated freeze-thaw cycles.
• Follow the written reconstitution guidance in how to reconstitute a lyophilized peptide and the diluent compatibility of your own assay. Specific volumes and concentrations belong in your own validated protocol, not in a supplier blog.
• Record lot number, opening date and storage conditions for every vial. Comparing two peptides is only meaningful if handling history is controlled.

Differences between the two are modest. Sermorelin, being shorter, tends to be simpler to characterize and may be less prone to aggregation. Tesamorelin, being longer and carrying a hydrophobic cap, can be somewhat more sensitive to solvent choice and surface adsorption, so low-binding labware is a sensible habit. Neither peptide should be assumed stable in solution over long periods; confirm with your own analytical checks.

What each certificate of analysis should show

A certificate of analysis (COA) is only useful if it comes from a defined method and is tied to a specific lot. The same checklist applies to both peptides, with a couple of peptide-specific points. For a walk-through of the format, read how to read a COA.

Identity

Look for an observed molecular mass that matches the expected mass. For sermorelin that is about 3,358 Da; for tesamorelin about 5,136 Da. Because larger peptides often appear as multiply charged ions, the report may show a deconvoluted mass or a series of charge states. For tesamorelin, an identity result that matches the unmodified 44-mer mass would be a red flag, since it would suggest the N-terminal group is missing. The mass difference of the hexenoyl cap is about 96 Da (C6H8O added in place of a hydrogen).

Purity

Reversed-phase HPLC purity is reported as the main peak's share of total peak area at a stated wavelength, commonly 214 or 220 nm. Check the gradient, column and integration notes, not only the headline percentage. Understanding HPLC purity explains what the number can and cannot tell you, and HPLC vs mass spectrometry explains why a purity trace and an identity result answer different questions. For tesamorelin, ask whether the method separates the capped peptide from the uncapped 44-mer; for sermorelin, whether it resolves truncated and oxidized forms.

Endotoxin

If material will be used in cell culture or other endotoxin-sensitive systems, a bacterial endotoxin result (typically LAL, reported in EU per mg or EU per mL) matters at least as much as purity. Many suppliers omit it, so it is worth asking whether the figure exists for the lot you hold.

Other fields to expect

• Lot number matching the vial label
• Test date and the name of the laboratory
• Appearance of the lyophilized cake
• Peptide content or water content, if reported, since net peptide is lower than gross weight
• Counter-ion (acetate or other), because it affects the mass you weigh out

On our side, the independent lab report for our Tesamorelin 10 mg lot is linked from the COA page and from the product page. We publish third-party lab reports there for products where one is available and are adding more over time. We do not currently have a published report to point to for Sermorelin, so check the COA page directly rather than assuming one exists. For background on why independent testing matters, see third-party testing explained.

Which research questions each is used to study

The two peptides are chosen for different reasons in preclinical work. Nothing below describes use in people or any expected benefit; these are experimental design considerations.

Where sermorelin is typically used

• Receptor pharmacology: as a compact reference agonist for GHRH receptor binding and cAMP assays, where a short, well-defined fragment is convenient.
• Structure-activity studies: as the baseline for testing how substitutions within the first 29 residues alter receptor activation.
• Degradation studies: as a known DPP-IV substrate, useful for characterizing peptidase activity in a matrix or comparing stabilized analogs.
• Pituitary cell models: short-exposure stimulation of primary or immortalized somatotroph-like cultures.

More detail is in the sermorelin research overview.

Where tesamorelin is typically used

• Persistence studies: comparing how the N-terminal cap changes the lifetime of the intact peptide in matrices containing DPP-IV.
• Full-length GHRH models: experiments in which the C-terminal region (residues 30-44) may matter, such as interactions beyond the core activating domain.
• Longer-duration in vitro designs: where a peptide that degrades more slowly keeps the effective exposure steadier over the assay window.
• Analytical method development: characterizing acylated peptides and resolving capped from uncapped species by chromatography and mass analysis.

More detail is in the tesamorelin research overview.

Choosing between them

A reasonable rule of thumb: if the experiment needs a simple, well-characterized reference GHRH agonist, sermorelin is the usual pick. If the experiment is sensitive to enzymatic loss of peptide, or the question involves the full-length sequence, tesamorelin is the more natural fit. Running both side by side in one assay, with identical handling, is the cleanest way to isolate the effect of the extra residues and the N-terminal cap.

Sourcing considerations

Whichever peptide you select, the same supplier questions apply: is there an independent report for the lot, what methods were used, does the identity data match the expected mass, and how is the material packed and shipped? Our general advice is collected in choosing a peptide supplier. If you want product-specific buying notes, see where to buy tesamorelin and where to buy sermorelin. Orders ship from Florida by USPS. Shipping details are on the shipping page. Questions can go through the contact page.

Common questions

Are tesamorelin and sermorelin the same molecule?

No. They share the first 29 residues, but tesamorelin continues to residue 44 and has a trans-3-hexenoyl group on the N-terminus. Sermorelin stops at residue 29 and has a free N-terminus.

Which is larger?

Tesamorelin, at about 5.1 kDa versus about 3.4 kDa for sermorelin. The difference comes mostly from the 15 extra residues, plus about 96 Da from the hexenoyl group.

Why is sermorelin cleared so quickly in biological matrices?

Its free N-terminus and Ala2-Asp3 bond make it a good DPP-IV substrate. Cleavage after residue 2 yields an inactive or much weaker fragment, so the intact peptide disappears within minutes in peptidase-rich systems.

Does the hexenoyl group make tesamorelin chemically stable in solution?

Not in a general sense. It slows one enzymatic cleavage. Oxidation of methionine and deamidation of Asn residues can still occur, so solution time should still be kept short.

Do both bind the same receptor?

Yes, both act at the GHRH receptor on pituitary somatotrophs. Neither is described as acting through the ghrelin receptor.

What mass should an identity result show for each?

Roughly 3,358 Da for sermorelin and roughly 5,136 Da for tesamorelin (free base, average mass). A tesamorelin result near 5,040 Da would point to a missing N-terminal cap.

Is HPLC purity enough to compare two lots?

Not on its own. Purity says how much of the signal belongs to the main peak, not whether that peak is the right molecule. Pair it with an identity result and, where relevant, endotoxin data.

Does a lyophilized peptide need the same storage for both?

Broadly yes: cold, dry, dark and sealed, brought to room temperature before opening. Follow the supplier's label and verify with your own stability checks.

Does V8 have a lab report for both products?

The independent report for our Tesamorelin 10 mg lot is linked from the COA page. We have no published report to point to for Sermorelin at this time, and we are adding reports as they become available.

Can I use these for anything other than laboratory research?

No. They are sold as laboratory research materials only and are not intended for human or animal consumption.

References

• Frohman LA, Kineman RD. Growth hormone-releasing hormone and pituitary development, hyperplasia and tumorigenesis. Trends in Endocrinology and Metabolism, 2002.
• Frohman LA, Downs TR, Williams TC, et al. Rapid enzymatic degradation of growth hormone-releasing hormone by plasma in vitro and in vivo to a biologically inactive product cleaved at the Ala2-Asp3 bond. Journal of Clinical Endocrinology and Metabolism, 1986.
• Mayo KE, Miller T, DeAlmeida V, Godfrey P, Zheng J, Cunha SR. Regulation of the pituitary somatotroph cell by GHRH and its receptor. Recent Progress in Hormone Research, 2000.
• United States Pharmacopeia. General Chapter <85> Bacterial Endotoxins Test.