VIP (Vasoactive Intestinal Peptide)
28-amino-acid neuropeptide
Coming soon
Leave your email and we'll tell you the day it goes on sale.
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family. Coming soon. Research use only.
Research applications
- 01VPAC1/VPAC2 receptor research
- 02cAMP signaling studies
- 03Neuro-immune pathway models
- Sizes
- 10 mg
- Purity
- ≥98% (supplier specification)
- Molecular formula
- C147H238N44O42S
- Sequence / identity
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Supplied form
- Lyophilized powder
- Storage
- Refrigerate at 2–8 °C; −20 °C for long-term. Protect from heat, moisture & light.
- Container
- Sealed clear glass research vial
Research Use Only. All products are sold strictly for laboratory research and development purposes only. Not for human or animal consumption. Not a drug, food, or cosmetic. By purchasing, you affirm you are a qualified researcher or institution.
Batch documentation
Batch-specific analytical documentation supports receiving, verification, and internal recordkeeping.
Storage guidance
Refrigerate the supplied material, freeze for long-term storage, and protect it from heat, moisture, and light.
Research-only labeling
Every vial is clearly identified for laboratory research use only — not for human or veterinary use.
What is VIP (Vasoactive Intestinal Peptide)?
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family. It signals through the VPAC1 and VPAC2 G-protein-coupled receptors and raises cyclic AMP, which makes it a common tool compound in receptor pharmacology and neuro-immune research models.
Where it is used in the lab
- VPAC1 and VPAC2 binding and cAMP assays
- Smooth-muscle and epithelial cell models
- Neuro-immune signaling studies
Availability
VIP (Vasoactive Intestinal Peptide) is coming soon to the V8 catalog as a 10 mg research vial of lyophilized powder. It is not on sale yet. Leave your email on this page and we will send one message the day it goes on sale.
Handling for research
Lyophilized material is kept sealed, cold and protected from light until use. For concentration math once the vial is available, use the reconstitution calculator. Certificates of analysis are published on the COA page for tested lots.
For laboratory research use only; not for human consumption.
Frequently Asked Questions
How is VIP (Vasoactive Intestinal Peptide) supplied and stored?+
VIP (Vasoactive Intestinal Peptide) is supplied as a lyophilized powder. Refrigerate at 2–8 °C, or freeze at −20 °C for long-term storage. Protect from heat, moisture, and light.
Do you provide a Certificate of Analysis?+
Certificates of Analysis from our independent lab are published for tested lots (see the COA page), and we add more as reports come back. Contact us for the status of a specific product or lot.
Is VIP (Vasoactive Intestinal Peptide) approved for human use?+
No. This product is sold strictly for laboratory research and development purposes and is not for human or animal consumption.