LL-37
Human cathelicidin peptide
Coming soon
Leave your email and we'll tell you the day it goes on sale.
LL-37 is the 37-amino-acid active fragment of the human cathelicidin protein hCAP18. Coming soon. Research use only.
Research applications
- 01Antimicrobial-peptide research
- 02Membrane-disruption assays
- 03Innate-immune signaling studies
- Sizes
- 10 mg
- Purity
- ≥98% (supplier specification)
- Molecular formula
- C205H340N60O53
- Sequence / identity
- [LL-37, 37 aa]
- Supplied form
- Lyophilized powder
- Storage
- Refrigerate at 2–8 °C; −20 °C for long-term. Protect from heat, moisture & light.
- Container
- Sealed clear glass research vial
Research Use Only. All products are sold strictly for laboratory research and development purposes only. Not for human or animal consumption. Not a drug, food, or cosmetic. By purchasing, you affirm you are a qualified researcher or institution.
Batch documentation
Batch-specific analytical documentation supports receiving, verification, and internal recordkeeping.
Storage guidance
Refrigerate the supplied material, freeze for long-term storage, and protect it from heat, moisture, and light.
Research-only labeling
Every vial is clearly identified for laboratory research use only — not for human or veterinary use.
What is LL-37?
LL-37 is the 37-amino-acid active fragment of the human cathelicidin protein hCAP18. It is an amphipathic, alpha-helical host-defense peptide and a standard reference compound in antimicrobial-peptide research, where its membrane activity and its signaling effects on immune cells are studied in vitro.
Where it is used in the lab
- Minimum inhibitory concentration and membrane-disruption assays
- Biofilm models
- Immune-cell signaling studies
Availability
LL-37 is coming soon to the V8 catalog as a 10 mg research vial of lyophilized powder. It is not on sale yet. Leave your email on this page and we will send one message the day it goes on sale.
Handling for research
Lyophilized material is kept sealed, cold and protected from light until use. For concentration math once the vial is available, use the reconstitution calculator. Certificates of analysis are published on the COA page for tested lots.
For laboratory research use only; not for human consumption.
Frequently Asked Questions
How is LL-37 supplied and stored?+
LL-37 is supplied as a lyophilized powder. Refrigerate at 2–8 °C, or freeze at −20 °C for long-term storage. Protect from heat, moisture, and light.
Do you provide a Certificate of Analysis?+
Certificates of Analysis from our independent lab are published for tested lots (see the COA page), and we add more as reports come back. Contact us for the status of a specific product or lot.
Is LL-37 approved for human use?+
No. This product is sold strictly for laboratory research and development purposes and is not for human or animal consumption.